額外資訊

Product No.	Ab02169-8.4-BT
Product Name	Anti-SUR2B [N323B/20] – (Purified)
Size	1 mg – (Bulk size)
Clone ID	N323B/20
Isotype	IgG2b Kappa
Host	Rat
Reactivity	Rat
Immunogen	This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
Conjugation	Unconjugated
Heavy Chain Modification	Fc Silent™
Product Type	Purified antibody in bulk size.
Tested Application	ICC; IHC; WB
Uniprot	Q63563
Availability	Ships in 5-6 weeks
Original Species	Mouse
Original Format	IgG2a
Chimeric Statement	This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Storage Buffer	PBS only.
Shipping Temp.	Wet Ice
Storage Temperature	Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot

Anti-SUR2B [N323B/20] (Ab02169-8.4-BT)